PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.5NG401400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family M-type_MADS
Protein Properties Length: 230aa    MW: 24254.6 Da    PI: 8.7474
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.5NG401400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF69.14e-221865249
                         ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
               SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                         rie++  rqv fskRr+g++KKA+ELS+LC+a+va ++fs+ gk + +
  Pavir.5NG401400.1.p 18 RIESDEARQVCFSKRRAGLFKKASELSILCGADVAAVVFSPAGKAFSF 65
                         8******************************************97766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554551.83E-29982IPR002100Transcription factor, MADS-box
PROSITE profilePS5006626.717969IPR002100Transcription factor, MADS-box
SMARTSM004325.7E-35968IPR002100Transcription factor, MADS-box
CDDcd002651.11E-411081No hitNo description
PRINTSPR004043.1E-201131IPR002100Transcription factor, MADS-box
PfamPF003193.1E-261865IPR002100Transcription factor, MADS-box
PRINTSPR004043.1E-203146IPR002100Transcription factor, MADS-box
PRINTSPR004043.1E-204667IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 230 aa     Download sequence    Send to blast
MAPPRRPSMG RQKIEIRRIE SDEARQVCFS KRRAGLFKKA SELSILCGAD VAAVVFSPAG  60
KAFSFGHPSV ESILDRFLDT SPEAGAGLSS AGDRAVSELN RQYGELRAQL DAEKVRQERA  120
DETIRKERAA RSQAMAWLYA DLGAMGHDDL VAFWGALIGV QAAVAASADQ LLRDALLVGR  180
RGRPQPPQLA GGVAFDVAAF GVGMQPPPGL AGVDLNGLGG QATILGPSF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P2e-15982174Myocyte-specific enhancer factor 2B
1tqe_Q2e-15982174Myocyte-specific enhancer factor 2B
1tqe_R2e-15982174Myocyte-specific enhancer factor 2B
1tqe_S2e-15982174Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9626541e-128EU962654.1 Zea mays clone 244495 DNA binding protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004953445.11e-142PREDICTED: agamous-like MADS-box protein AGL29
TrEMBLK3Z0901e-142K3Z090_SETIT; Uncharacterized protein
STRINGSi019951m1e-142(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP122436128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24840.15e-34AGAMOUS-like 61